PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC049096.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 351aa    MW: 39756.8 Da    PI: 6.6805
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC049096.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.6e-33213268156
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                   k+r++W+peLH+rFvea+eqLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  EcC049096.50 213 KQRRCWSPELHRRFVEALEQLGGAQVATPKQIRELMQVEGLTNDEVKSHLQKYRLH 268
                   79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.03E-18210271IPR009057Homeodomain-like
PROSITE profilePS5129412.811210270IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-30212272IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-27213268IPR006447Myb domain, plants
PfamPF002493.6E-8215266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0005507Molecular Functioncopper ion binding
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MELSLDLSLA REPRPVSEFF REVSGIPDRD ERLSKLDDYV ARLEEEMRKI DPFKRELPLC  60
MLLLNDAMER LKEERLQCKD MEFIRPNRNS DKDKRAEVEN KDSCDQRKWM SSPDQNLDQY  120
AAEKNPIGPC SYKKKGGAFL PFGLHRAPPK EGKDSSPISR LTLLTPGSML ASPDNDNIKK  180
LSFEAPFSTD HEKLQKSPQQ AQQHRLQQHQ LRKQRRCWSP ELHRRFVEAL EQLGGAQVAT  240
PKQIRELMQV EGLTNDEVKS HLQKYRLHVR RIPSPSAAVE NGLSLVQERS GVDHSELRTS  300
ESDSPQGPLL ACASARAASS AGGGSAEMTD EEENSEGHSW ITVLGEKITA H
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010070500.10.0PREDICTED: uncharacterized protein LOC104457261
TrEMBLA0A059AZA40.0A0A059AZA4_EUCGR; Uncharacterized protein
STRINGVIT_07s0197g00060.t011e-104(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.19e-61G2-like family protein